PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0127s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 341aa    MW: 38009.3 Da    PI: 4.6676
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0127s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.59.4e-082833172155
                             HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                             k +yp+++++  LA+++gL+++q+ +WF  +R ++
  SapurV1A.0127s0040.1.p 283 KWPYPTEADKVALAESTGLDQKQINNWFIKQRKRH 317
                             569*************************9888775 PP

2ELK30.76.9e-11237258122
                     ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                             ELK+ LlrKYsgy+++Lk+ Fs
  SapurV1A.0127s0040.1.p 237 ELKDKLLRKYSGYISTLKHAFS 258
                             9*****************8665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.8E-2297141IPR005540KNOX1
PfamPF037903.5E-2198136IPR005540KNOX1
SMARTSM012565.5E-27149200IPR005541KNOX2
PfamPF037911.0E-23153199IPR005541KNOX2
PROSITE profilePS512139.551237257IPR005539ELK domain
SMARTSM011882.6E-6237258IPR005539ELK domain
PfamPF037896.0E-10237258IPR005539ELK domain
PROSITE profilePS5007111.58257320IPR001356Homeobox domain
SMARTSM003896.2E-12259324IPR001356Homeobox domain
SuperFamilySSF466896.84E-18259333IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.9E-26262321IPR009057Homeodomain-like
CDDcd000861.09E-12269321No hitNo description
PfamPF059201.3E-14277316IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MMEELYGLQS TSSDYSFQVP SENMVAPVAN YYHPVGFTSP AGEPSFPVFG SEQMFCGSSV  60
SDAASMVAEL HQQHQQRGGA GVGDHSNSNN SEEEVSCAIR AKIASHPLYP KLLEAYIDCQ  120
KVGAPPEMAY LLDEIRLAND VSKGSNDTVA SCLGADPELD EFMETYCDVL MKYKADLSRP  180
FDEATTFLND IEAQFNTLCN GPSRSQVYDE AAGSSDEDGS GGEADVQDCS RINEDRELKD  240
KLLRKYSGYI STLKHAFSKQ KKKGKLPKEA RQILLNWWNI HNKWPYPTEA DKVALAESTG  300
LDQKQINNWF IKQRKRHWKP SENMQFSVVD SLYGPFFMND *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011040492.10.0PREDICTED: homeobox protein knotted-1-like 2
SwissprotQ84JS61e-107KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLB9RAZ81e-157B9RAZ8_RICCO; Homeobox protein knotted-1, putative
STRINGVIT_17s0000g08710.t011e-155(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-101KNOTTED1-like homeobox gene 6